Lineage for d5v6ab_ (5v6a B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540462Domain d5v6ab_: 5v6a B: [334319]
    Other proteins in same PDB: d5v6aa2
    automated match to d2knba_
    complexed with cl, flc, zn

Details for d5v6ab_

PDB Entry: 5v6a (more details), 2.7 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.2
PDB Compounds: (B:) me.2

SCOPe Domain Sequences for d5v6ab_:

Sequence, based on SEQRES records: (download)

>d5v6ab_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrifvetlrrltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdyn
ivkystlhlilrlpr

Sequence, based on observed residues (ATOM records): (download)

>d5v6ab_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrifveltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdynivky
stlhlilrlpr

SCOPe Domain Coordinates for d5v6ab_:

Click to download the PDB-style file with coordinates for d5v6ab_.
(The format of our PDB-style files is described here.)

Timeline for d5v6ab_: