![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
![]() | Domain d5ut2a_: 5ut2 A: [335226] automated match to d1ir3a_ complexed with 3yt, act, gol |
PDB Entry: 5ut2 (more details), 1.75 Å
SCOPe Domain Sequences for d5ut2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ut2a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vfhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesff eaasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevak qlaaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqer ipwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpap kaaelanlinncmdyepdhrpsfraiirdlnsl
Timeline for d5ut2a_: