Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily) unusual fold |
Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) |
Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins) |
Protein automated matches [330535] (1 species) not a true protein |
Species Bordetella pertussis [TaxId:257313] [330536] (2 PDB entries) |
Domain d5us8a2: 5us8 A:190-442 [330575] Other proteins in same PDB: d5us8a1, d5us8a3, d5us8b1, d5us8b3 automated match to d1k92a2 complexed with adn, epe, pge, so4 |
PDB Entry: 5us8 (more details), 2.15 Å
SCOPe Domain Sequences for d5us8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5us8a2 d.210.1.1 (A:190-442) automated matches {Bordetella pertussis [TaxId: 257313]} aystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrfeegqpval ngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallfiayerlvt gihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevtlelrrgnd ysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklftyvktgll apsagsalpqikd
Timeline for d5us8a2: