Lineage for d5us8a1 (5us8 A:1-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861554Species Bordetella pertussis [TaxId:257313] [330533] (2 PDB entries)
  8. 2861556Domain d5us8a1: 5us8 A:1-189 [330574]
    Other proteins in same PDB: d5us8a2, d5us8a3, d5us8b2, d5us8b3
    automated match to d1k92a1
    complexed with adn, epe, pge, so4

Details for d5us8a1

PDB Entry: 5us8 (more details), 2.15 Å

PDB Description: 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d5us8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us8a1 c.26.2.0 (A:1-189) automated matches {Bordetella pertussis [TaxId: 257313]}
mttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeiprra
mqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaamke
dgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymrqag
fdykmsaek

SCOPe Domain Coordinates for d5us8a1:

Click to download the PDB-style file with coordinates for d5us8a1.
(The format of our PDB-style files is described here.)

Timeline for d5us8a1: