Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Providencia stuartii [TaxId:588] [331391] (6 PDB entries) |
Domain d5us1d_: 5us1 D: [331480] Other proteins in same PDB: d5us1a2, d5us1c2, d5us1e2, d5us1j2, d5us1k2 automated match to d1m44a_ complexed with 8mm, aco, coa, gol, tar |
PDB Entry: 5us1 (more details), 2.48 Å
SCOPe Domain Sequences for d5us1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5us1d_ d.108.1.0 (D:) automated matches {Providencia stuartii [TaxId: 588]} gieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghvai iqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgqk lyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw
Timeline for d5us1d_: