Lineage for d5umhb_ (5umh B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2770308Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2770309Protein automated matches [227026] (6 species)
    not a true protein
  7. 2770317Species Burkholderia multivorans [TaxId:395019] [329904] (1 PDB entry)
  8. 2770319Domain d5umhb_: 5umh B: [329905]
    automated match to d1dmha_
    complexed with ca, cl, edo, pg4, pg6, zn

Details for d5umhb_

PDB Entry: 5umh (more details), 1.35 Å

PDB Description: crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
PDB Compounds: (B:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d5umhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umhb_ b.3.6.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]}
svkvfdtkevqdllkaaanlngdagnarfrqivhrllsdlfkaiddlditpdevwagvny
lnklgqdgeaallaagiglekyldirmdaadraagldggtprtiegplyvagapvrdgva
kidldddadagplvirgtvtgtdgkplagalvecwhanskgfyshfdptgaqtafnlrga
vrtdangkyefrtlmpvgygcppqgatqqllnglgrhgnrpahvhffvsgdghrklttqf
niegdpliwddfayatreeliphvvdktggaalgmksdaykeiefdivltplldgrdnqv
vhrprasada

SCOPe Domain Coordinates for d5umhb_:

Click to download the PDB-style file with coordinates for d5umhb_.
(The format of our PDB-style files is described here.)

Timeline for d5umhb_: