Lineage for d5umfa_ (5umf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827642Species Neisseria gonorrhoeae [TaxId:521006] [329871] (1 PDB entry)
  8. 2827643Domain d5umfa_: 5umf A: [329872]
    automated match to d3ovrb_
    complexed with gol, po4, zn

Details for d5umfa_

PDB Entry: 5umf (more details), 1.4 Å

PDB Description: crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate
PDB Compounds: (A:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d5umfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umfa_ c.1.2.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
ayriapsilsadfarlgeevanviaagadlihfdvmdnhyvpnltfgpmvcaalkpyasv
pidvhlmvepvddliqsfakagasiitfhpeasrhidrslslirdmgcqaglvlnpatpv
yvlenvldrldmvllmsvnpgfggqsfiphtlekirqvramldryegksgrriaievdgg
iktdniaavaragadtfvagsaifgkpdykaviaamraeleka

SCOPe Domain Coordinates for d5umfa_:

Click to download the PDB-style file with coordinates for d5umfa_.
(The format of our PDB-style files is described here.)

Timeline for d5umfa_: