Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (36 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:521006] [329871] (1 PDB entry) |
Domain d5umfa_: 5umf A: [329872] automated match to d3ovrb_ complexed with gol, po4, zn |
PDB Entry: 5umf (more details), 1.4 Å
SCOPe Domain Sequences for d5umfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5umfa_ c.1.2.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} ayriapsilsadfarlgeevanviaagadlihfdvmdnhyvpnltfgpmvcaalkpyasv pidvhlmvepvddliqsfakagasiitfhpeasrhidrslslirdmgcqaglvlnpatpv yvlenvldrldmvllmsvnpgfggqsfiphtlekirqvramldryegksgrriaievdgg iktdniaavaragadtfvagsaifgkpdykaviaamraeleka
Timeline for d5umfa_: