Lineage for d5ujta1 (5ujt A:0-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938696Domain d5ujta1: 5ujt A:0-81 [343339]
    Other proteins in same PDB: d5ujta2, d5ujtb1, d5ujtb2, d5ujtd2, d5ujte1, d5ujte2, d5ujtg2, d5ujth1, d5ujth2
    automated match to d4z7ua1
    complexed with nag

Details for d5ujta1

PDB Entry: 5ujt (more details), 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3
PDB Compounds: (A:) MHC class II antigen

SCOPe Domain Sequences for d5ujta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujta1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
altniavlkhnlncvikrsnsta

SCOPe Domain Coordinates for d5ujta1:

Click to download the PDB-style file with coordinates for d5ujta1.
(The format of our PDB-style files is described here.)

Timeline for d5ujta1:

2938696
d5ujta1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5ujta2