![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.100.2: MbtH-like [160582] (2 families) ![]() the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position |
![]() | Family d.100.2.0: automated matches [254253] (1 protein) not a true family |
![]() | Protein automated matches [254578] (8 species) not a true protein |
![]() | Species Geobacillus sp. [TaxId:581103] [334347] (1 PDB entry) |
![]() | Domain d5u89b_: 5u89 B: [334348] automated match to d2gpfa1 complexed with mj8 |
PDB Entry: 5u89 (more details), 3.08 Å
SCOPe Domain Sequences for d5u89b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u89b_ d.100.2.0 (B:) automated matches {Geobacillus sp. [TaxId: 581103]} tnpfenkegtylvlindegqyslwpasiaippgwniafaentrsacldyinahwidmrpn slkd
Timeline for d5u89b_: