Lineage for d5tviw_ (5tvi W:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
4 helices; folded leaf; right-handed superhelixSuperfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) 
can be classified as disulfide-rich
Family a.52.1.0: automated matches [254196] (1 protein)
not a true familyProtein automated matches [254428] (8 species)
not a true protein
Species Solanum melongena [TaxId:4111] [336505] (5 PDB entries) 
Domain d5tviw_: 5tvi W: [336515]
automated match to d1rzla_
complexed with gol, myr, o8n
Details for d5tviw_
PDB Entry: 5tvi (more details), 1.87 Å
PDB Description: crystal structure of non-specific lipid transfer protein reveals non- canonical lipid binding: possible relevance in modulating allergenicity
PDB Compounds: (W:) non specific lipid transfer proteinSCOPe Domain Sequences for d5tviw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tviw_ a.52.1.0 (W:) automated matches {Solanum melongena [TaxId: 4111]}
avtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanryp
nlkddaaqslpskcgislnvpisrtincdtis
SCOPe Domain Coordinates for d5tviw_:
Click to download the PDB-style file with coordinates for d5tviw_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5tviw_:
- d5tviw_ first appeared in SCOPe 2.06
- d5tviw_ appears in SCOPe 2.07
View in 3D
