Lineage for d5tl6b1 (5tl6 B:2-62)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540527Species Human sars coronavirus [TaxId:227859] [333835] (3 PDB entries)
  8. 2540530Domain d5tl6b1: 5tl6 B:2-62 [333840]
    Other proteins in same PDB: d5tl6b2, d5tl6d2
    automated match to d3e9sa1
    complexed with so4, zn

Details for d5tl6b1

PDB Entry: 5tl6 (more details), 2.62 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d5tl6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl6b1 d.15.1.0 (B:2-62) automated matches {Human sars coronavirus [TaxId: 227859]}
evktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlps
d

SCOPe Domain Coordinates for d5tl6b1:

Click to download the PDB-style file with coordinates for d5tl6b1.
(The format of our PDB-style files is described here.)

Timeline for d5tl6b1:

2540530
d5tl6b1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5tl6b2