Lineage for d5t8wa_ (5t8w A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304491Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
    Uniprot P00044
  8. 2304515Domain d5t8wa_: 5t8w A: [341011]
    automated match to d1s6vb_
    complexed with cl, hec

Details for d5t8wa_

PDB Entry: 5t8w (more details), 1.6 Å

PDB Description: cytochrome c - calixarene free
PDB Compounds: (A:) Cyc1p

SCOPe Domain Sequences for d5t8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8wa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d5t8wa_:

Click to download the PDB-style file with coordinates for d5t8wa_.
(The format of our PDB-style files is described here.)

Timeline for d5t8wa_:

2304515
d5t8wa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5t8wb_