Lineage for d5t8sa1 (5t8s A:2-103)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. Protein automated matches [254617] (15 species)
    not a true protein
  7. Species Neisseria gonorrhoeae [TaxId:242231] [323456] (2 PDB entries)
  8. Domain d5t8sa1: 5t8s A:2-103 [323496]
    automated match to d1mxaa1
    complexed with 3po, amp, mg, po4, pop, sam

Details for d5t8sa1

PDB Entry: 5t8s (more details), 1.7000000000000002 Å

PDB Description: crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d5t8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8sa1 d.130.1.0 (A:2-103) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
seylftsesvseghpdkvadqvsdaildailaqdpkarvaaetlvntglcvlageittta
qvdyikvaretikrigynsselgfdangcavgvyydqqspdi

SCOPe Domain Coordinates for d5t8sa1 are not available.

Timeline for d5t8sa1:

Domains from same chain:
(mouse over for more information)
d5t8sa2, d5t8sa3
Domains from other chains:
(mouse over for more information)
d5t8sb1, d5t8sb2, d5t8sb3