Lineage for d5t5xa1 (5t5x A:3-205)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-likeSuperfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) 
automatically mapped to Pfam PF00875Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) 
Protein Cryptochrome [82367] (3 species) 
Species Mouse (Mus musculus) [TaxId:10090] [226829] (3 PDB entries) 
Domain d5t5xa1: 5t5x A:3-205 [329548]
Other proteins in same PDB: d5t5xa2
automated match to d4k0ra1
complexed with cl
Details for d5t5xa1
PDB Entry: 5t5x (more details), 1.84 Å
PDB Description: high resolution structure of mouse cryptochrome 1
PDB Compounds: (A:) Cryptochrome-1SCOPe Domain Sequences for d5t5xa1:
Sequence, based on SEQRES records: (download)
>d5t5xa1 c.28.1.1 (A:3-205) Cryptochrome {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcledl
danlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagv
evivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtpl
sddhdekygvpsleelgfdtdgl
Sequence, based on observed residues (ATOM records): (download)
>d5t5xa1 c.28.1.1 (A:3-205) Cryptochrome {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyilvginrwrfllqcledldanlrklns
rlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivrisht
lydldkiielnggqppltykrfqtlvskmepitsdvigkcmtplsddhdekygvpsleel
gfdtdgl
SCOPe Domain Coordinates for d5t5xa1:
Click to download the PDB-style file with coordinates for d5t5xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5t5xa1:
View in 3D
