Lineage for d5oy0d_ (5oy0 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611483Species Synechocystis sp. [TaxId:1111708] [347289] (2 PDB entries)
  8. 2611485Domain d5oy0d_: 5oy0 D: [347880]
    Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_
    automated match to d1jb0d_
    complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd

Details for d5oy0d_

PDB Entry: 5oy0 (more details), 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution
PDB Compounds: (D:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d5oy0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oy0d_ d.187.1.1 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mtelsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllyla
rkeqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktr
rigqnpepvtikfsgkapyev

SCOPe Domain Coordinates for d5oy0d_:

Click to download the PDB-style file with coordinates for d5oy0d_.
(The format of our PDB-style files is described here.)

Timeline for d5oy0d_: