Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (8 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347289] (2 PDB entries) |
Domain d5oy0d_: 5oy0 D: [347880] Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_ automated match to d1jb0d_ complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd |
PDB Entry: 5oy0 (more details), 2.5 Å
SCOPe Domain Sequences for d5oy0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oy0d_ d.187.1.1 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]} mtelsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllyla rkeqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktr rigqnpepvtikfsgkapyev
Timeline for d5oy0d_: