Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (10 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347566] (2 PDB entries) |
Domain d5oy0c_: 5oy0 c: [347567] Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy04_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_ automated match to d4kt0c_ complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex |
PDB Entry: 5oy0 (more details), 2.5 Å
SCOPe Domain Sequences for d5oy0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oy0c_ d.58.1.2 (c:) automated matches {Synechocystis sp. [TaxId: 1111708]} mshsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacpt dflsirvylgaettrsmglay
Timeline for d5oy0c_: