Lineage for d5oy0c_ (5oy0 c:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949145Protein automated matches [236563] (10 species)
    not a true protein
  7. 2949172Species Synechocystis sp. [TaxId:1111708] [347566] (2 PDB entries)
  8. 2949174Domain d5oy0c_: 5oy0 c: [347567]
    Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy04_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_
    automated match to d4kt0c_
    complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex

Details for d5oy0c_

PDB Entry: 5oy0 (more details), 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution
PDB Compounds: (c:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d5oy0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oy0c_ d.58.1.2 (c:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mshsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacpt
dflsirvylgaettrsmglay

SCOPe Domain Coordinates for d5oy0c_:

Click to download the PDB-style file with coordinates for d5oy0c_.
(The format of our PDB-style files is described here.)

Timeline for d5oy0c_: