Lineage for d5ogjb_ (5ogj B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
single sheet; 10 strandsSuperfamily b.74.1: Carbonic anhydrase [51069] (2 families) 
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
automatically mapped to Pfam PF00194
Protein automated matches [190681] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries) 
Domain d5ogjb_: 5ogj B: [355524]
automated match to d3d0na_
complexed with act, cit, edo, peg, v90, zn
Details for d5ogjb_
PDB Entry: 5ogj (more details), 1.06 Å
PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 2- (cyclooctylamino)-3,5,6-trifluoro-4-[(2-hydroxyethyl) thio]benzenesulfonamide
PDB Compounds: (B:) Carbonic anhydrase 13SCOPe Domain Sequences for d5ogjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ogjb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
aflvsnhrppqplkgrkvrasfh
SCOPe Domain Coordinates for d5ogjb_:
Click to download the PDB-style file with coordinates for d5ogjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ogjb_:
- d5ogjb_ is new in SCOPe 2.07-stable
- d5ogjb_ appears in the current release, SCOPe 2.08
View in 3D
