Lineage for d5ogjb_ (5ogj B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. Protein automated matches [190681] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187805] (56 PDB entries)
  8. Domain d5ogjb_: 5ogj B: [355524]
    automated match to d3d0na_
    complexed with act, cit, edo, peg, v90, zn

Details for d5ogjb_

PDB Entry: 5ogj (more details), 1.06 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 2- (cyclooctylamino)-3,5,6-trifluoro-4-[(2-hydroxyethyl) thio]benzenesulfonamide
PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5ogjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ogjb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
aflvsnhrppqplkgrkvrasfh

SCOPe Domain Coordinates for d5ogjb_ are not available.

Timeline for d5ogjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ogja_