Lineage for d5odqf_ (5odq F:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624599Species Methanothermococcus thermolithotrophicus [TaxId:523845] [338595] (5 PDB entries)
  8. 2624600Domain d5odqf_: 5odq F: [338606]
    automated match to d3ze7b_
    complexed with 9s8, 9sb, act, fad, fe, fes, gol, nfu, pe3, sf4, trs

Details for d5odqf_

PDB Entry: 5odq (more details), 2.15 Å

PDB Description: heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate.
PDB Compounds: (F:) Methyl-viologen reducing hydrogenase, subunit A

SCOPe Domain Sequences for d5odqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5odqf_ e.18.1.0 (F:) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
vklsvepvtrveghgkisvsfddsgnldkvrfhvvevrgfekflegryvedapiytpric
gicqvahhlasakavdnvfgvkipetaellrnlmhqgatvhshalhfymlaapdlmfptt
ddvlkrnlmgiakehpeiikdaielrkagqnvvrvvggraihpvtavvggqskslkeeer
dellklsertielseksievgkkllenikdedlldigyfesahmgmvnngvhdlydgklr
vvnsegkveyefdpseymnyiaegvkpysylkfpylkdkgeedgiyrvntlsrlnvsdkm
atplaqkyydefvkefgkpchhpmlfhyarliellssaemvkellendkivgediraepe
evvgdgvgcveaprgtlihhfktdddgiitdtnlvvatvqnnpamdigvrkvaekyikap
edatpqvlnymemliraydpclscath

SCOPe Domain Coordinates for d5odqf_:

Click to download the PDB-style file with coordinates for d5odqf_.
(The format of our PDB-style files is described here.)

Timeline for d5odqf_: