![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein Zn metallo-beta-lactamase [56283] (14 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [419789] (1 PDB entry) |
![]() | Domain d5o7nb_: 5o7n B: [353710] automated match to d5lsca_ complexed with 9nk, edo, fmt, zn |
PDB Entry: 5o7n (more details), 1.5 Å
SCOPe Domain Sequences for d5o7nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o7nb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Klebsiella pneumoniae [TaxId: 573]} eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
Timeline for d5o7nb_: