Lineage for d5o7nb_ (5o7n B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) 
Protein Zn metallo-beta-lactamase [56283] (14 species) 
Species Klebsiella pneumoniae [TaxId:573] [419789] (1 PDB entry) 
Domain d5o7nb_: 5o7n B: [353710]
automated match to d5lsca_
complexed with 9nk, edo, fmt, zn
Details for d5o7nb_
PDB Entry: 5o7n (more details), 1.5 Å
PDB Description: beta-lactamase vim-2 in complex with (2r)-1-(2-benzyl-3- mercaptopropanoyl)piperidine-2-carboxylic acid
PDB Compounds: (B:) beta-lactamase vim-2SCOPe Domain Sequences for d5o7nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o7nb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Klebsiella pneumoniae [TaxId: 573]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
SCOPe Domain Coordinates for d5o7nb_:
Click to download the PDB-style file with coordinates for d5o7nb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5o7nb_:
- d5o7nb_ first appeared in SCOPe 2.07
View in 3D
