Lineage for d5o2da_ (5o2d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881815Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2881816Protein automated matches [190146] (12 species)
    not a true protein
  7. 2881828Species Human (Homo sapiens) [TaxId:9606] [256134] (4 PDB entries)
  8. 2881829Domain d5o2da_: 5o2d A: [341272]
    automated match to d5cb5d_
    complexed with 9hh

Details for d5o2da_

PDB Entry: 5o2d (more details), 1.6 Å

PDB Description: parp14 macrodomain 2 with inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 14

SCOPe Domain Sequences for d5o2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2da_ c.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swekgslvspgglqmllvkegvqnaktdvvvnsvpldlvlsrgplsssllekagpelqee
ldtvgqgvavsmgtvlktsswnldcryvlhvvapewrngstsslkimediirecmeites
lslksiafpaigtgnlgfpknifaeliisevfsfsssnqlstlqevhfllhpsdheniqa
fsdefarra

SCOPe Domain Coordinates for d5o2da_:

Click to download the PDB-style file with coordinates for d5o2da_.
(The format of our PDB-style files is described here.)

Timeline for d5o2da_: