Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein automated matches [190412] (11 species) not a true protein |
Species Betula pendula [TaxId:3505] [340503] (2 PDB entries) |
Domain d5nzba_: 5nzb A: [340567] automated match to d1cqaa_ |
PDB Entry: 5nzb (more details), 1.7 Å
SCOPe Domain Sequences for d5nzba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nzba_ d.110.1.1 (A:) automated matches {Betula pendula [TaxId: 3505]} swqtyvdehlmcdidgqgqqlaasaivghdgsvwaqsssfpqfkpqeitgimkdfeepgh laptglhlggikymviqgeagavirgkkgsggitikktgqalvfgiyeepvtpgqcnmvv erlgdylidqgl
Timeline for d5nzba_: