Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein Numb [50762] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [342799] (1 PDB entry) |
Domain d5njjd_: 5njj D: [342805] automated match to d2nmba_ complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5njj (more details), 2.7 Å
SCOPe Domain Sequences for d5njjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5njjd_ b.55.1.2 (D:) Numb {Human (Homo sapiens) [TaxId: 9606]} deegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktgkkavkav lwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmav kdtgerlshavgcafaaclerkq
Timeline for d5njjd_: