Lineage for d5mdha1 (5mdh A:1-154)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) 
Protein Malate dehydrogenase [51849] (13 species) 
Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries) 
Domain d5mdha1: 5mdh A:1-154 [30126]
Other proteins in same PDB: d5mdha2, d5mdhb2
complexed with mak, nad
Details for d5mdha1
PDB Entry: 5mdh (more details), 2.4 Å
PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution
PDB Compounds: (A:) malate dehydrogenaseSCOPe Domain Sequences for d5mdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
ksvkvivvgnpantncltasksapsipkenfscl
SCOPe Domain Coordinates for d5mdha1:
Click to download the PDB-style file with coordinates for d5mdha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5mdha1:
- d5mdha1 first appeared (with stable ids) in SCOP 1.55
- d5mdha1 appears in SCOPe 2.04
- d5mdha1 appears in SCOPe 2.06
- d5mdha1 appears in the current release, SCOPe 2.08
View in 3D
