![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
![]() | Protein automated matches [190781] (45 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [332654] (9 PDB entries) |
![]() | Domain d5lu0a_: 5lu0 A: [339198] automated match to d4m3na_ complexed with edo, po4, trs |
PDB Entry: 5lu0 (more details), 1.73 Å
SCOPe Domain Sequences for d5lu0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lu0a_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
Timeline for d5lu0a_: