Lineage for d5lmml_ (5lmm L:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. Protein automated matches [191173] (15 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [330666] (14 PDB entries)
  8. Domain d5lmml_: 5lmm L: [337893]
    Other proteins in same PDB: d5lmms_, d5lmmt_
    automated match to d5a4il_
    complexed with cl, f3s, fco, li, lmt, mg, ni, sf3, sf4, so4, trs; mutant

Details for d5lmml_

PDB Entry: 5lmm (more details), 1.2 Å

PDB Description: structure of e coli hydrogenase hyd-1 mutant e28q
PDB Compounds: (L:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d5lmml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lmml_ e.18.1.0 (L:) automated matches {Escherichia coli [TaxId: 83333]}
stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d5lmml_ are not available.

Timeline for d5lmml_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5lmmm_, d5lmms_, d5lmmt_