Lineage for d5le5y_ (5le5 Y:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2599324Species Human (Homo sapiens) [TaxId:9606] [311421] (14 PDB entries)
  8. 2599328Domain d5le5y_: 5le5 Y: [321511]
    Other proteins in same PDB: d5le5a_, d5le5b_, d5le5c_, d5le5d_, d5le5e_, d5le5f_, d5le5g_, d5le5h_, d5le5i_, d5le5j_, d5le5m_, d5le5o_, d5le5p_, d5le5q_, d5le5r_, d5le5s_, d5le5t_, d5le5u_, d5le5v_, d5le5w_, d5le5x_
    automated match to d1irul_
    complexed with 1pe, cl, k, mg

Details for d5le5y_

PDB Entry: 5le5 (more details), 1.8 Å

PDB Description: native human 20s proteasome at 1.8 angstrom
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d5le5y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5le5y_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlheky

SCOPe Domain Coordinates for d5le5y_:

Click to download the PDB-style file with coordinates for d5le5y_.
(The format of our PDB-style files is described here.)

Timeline for d5le5y_: