Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (10 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries) |
Domain d5l8rc_: 5l8r C: [341215] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_ automated match to d4y28c_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8rc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd flsvrvylwhettrsmglay
Timeline for d5l8rc_: