Lineage for d5l8rc_ (5l8r C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949145Protein automated matches [236563] (10 species)
    not a true protein
  7. 2949162Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries)
  8. 2949169Domain d5l8rc_: 5l8r C: [341215]
    Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_
    automated match to d4y28c_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8rc_

PDB Entry: 5l8r (more details), 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d5l8rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8rc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d5l8rc_:

Click to download the PDB-style file with coordinates for d5l8rc_.
(The format of our PDB-style files is described here.)

Timeline for d5l8rc_: