Lineage for d5kx5c1 (5kx5 C:1-245)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (9 species)
not a true protein
Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries) 
Domain d5kx5c1: 5kx5 C:1-245 [327647]
Other proteins in same PDB: d5kx5b2, d5kx5c2, d5kx5d2, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3
automated match to d4ihja1
complexed with 6yk, adp, ca, gdp, gtp, mg
Details for d5kx5c1
PDB Entry: 5kx5 (more details), 2.5 Å
PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex
PDB Compounds: (C:) Tubulin alpha chainSCOPe Domain Sequences for d5kx5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kx5c1 c.32.1.1 (C:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
slrfd
SCOPe Domain Coordinates for d5kx5c1:
Click to download the PDB-style file with coordinates for d5kx5c1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5kx5c1:
- d5kx5c1 first appeared in SCOPe 2.06
- d5kx5c1 appears in SCOPe 2.07
View in 3D
