Lineage for d5kvua_ (5kvu A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 proteins)
    the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion
    automatically mapped to Pfam PF03971
  6. Protein automated matches [190493] (6 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [336802] (1 PDB entry)
  8. Domain d5kvua_: 5kvu A: [336803]
    automated match to d2b0ta_
    complexed with edo, gol, mla, mlt, nap, sin

Details for d5kvua_

PDB Entry: 5kvu (more details), 2.66 Å

PDB Description: crystal structure of isocitrate dehydrogenase-2 in complex with nadp(+) from mycobacterium tuberculosis
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d5kvua_:

Sequence, based on SEQRES records: (download)

>d5kvua_ c.77.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrv
pdnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadpktdqekai
keryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfy
ageksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqd
afetgvmfslhvkatmmkvshpivfghavrifykdafakhqelfddlgvnvnnglsdlys
kieslpasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggk
mygadgklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygs
hdktfeipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisg
mpvlfwldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaa
tgnilrdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrw
dslgeflalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqf
ylamywaqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsd
mttavmrpsktfnaaleav

Sequence, based on observed residues (ATOM records): (download)

>d5kvua_ c.77.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrv
pdnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadptdqekaik
eryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfya
geksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqda
fetgvmfslhvkatmmkvshpivfghavrifykdafakhqelfddlgvnvnnglsdlysk
ieslpasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggkm
ygadgklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygsh
dktfeipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisgm
pvlfwldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaat
gnilrdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrwd
slgeflalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqfy
lamywaqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsdm
ttavmrpsktfnaaleav

SCOPe Domain Coordinates for d5kvua_ are not available.

Timeline for d5kvua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5kvub_, d5kvuc_, d5kvud_