Lineage for d5kvab_ (5kva B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. Protein automated matches [190251] (6 species)
    not a true protein
  7. Species Sorghum (Sorghum bicolor) [TaxId:4558] [321178] (1 PDB entry)
  8. Domain d5kvab_: 5kva B: [321217]
    automated match to d1susa_
    complexed with ca, sam

Details for d5kvab_

PDB Entry: 5kva (more details), 1.83 Å

PDB Description: crystal structure of sorghum caffeoyl-coa o-methyltransferase (ccoaomt)
PDB Compounds: (B:) Caffeoyl-CoA O-methyltransferase

SCOPe Domain Sequences for d5kvab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvab_ c.66.1.1 (B:) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
hksllksddlyqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmliklig
akktmeigvytgysllatalalpedgtilamdinrenyelglpciekagvahkidfregp
alpvlddliadeknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvl
pddapmrkyirfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk

SCOPe Domain Coordinates for d5kvab_ are not available.

Timeline for d5kvab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5kvaa_