Lineage for d5kjba_ (5kjb A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. Family b.69.15.1: RPE65-like [310643] (2 proteins)
  6. Protein RPE65 [310786] (2 species)
  7. Species Synechocystis sp. [TaxId:1143] [311042] (12 PDB entries)
  8. Domain d5kjba_: 5kjb A: [320492]
    automated match to d5e47b_
    complexed with fe2; mutant

Details for d5kjba_

PDB Entry: 5kjb (more details), 2.8099999999999996 Å

PDB Description: synechocystis apocarotenoid oxygenase (aco) mutant - glu150asp
PDB Compounds: (A:) Apocarotenoid-15,15'-oxygenase

SCOPe Domain Sequences for d5kjba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kjba_ b.69.15.1 (A:) RPE65 {Synechocystis sp. [TaxId: 1143]}
qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
niantnitywgdrllalwdggqphrlepsnlatiglddlggilaegqplsahpridpast
fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt

SCOPe Domain Coordinates for d5kjba_ are not available.

Timeline for d5kjba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5kjbb_, d5kjbc_, d5kjbd_, d5kjbe_