Lineage for d5k3yb_ (5k3y B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the commentsProtein automated matches [190091] (20 species)
not a true protein
Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries) 
Domain d5k3yb_: 5k3y B: [321421]
automated match to d4c2vb_
complexed with 6q4, tpo
Details for d5k3yb_
PDB Entry: 5k3y (more details), 1.6 Å
PDB Description: crystal structure of aurorab/incenp in complex with bi 811283
PDB Compounds: (B:) aurora kinase b-aSCOPe Domain Sequences for d5k3yb_:
Sequence, based on SEQRES records: (download)
>d5k3yb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
alaempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehql
rreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfme
eladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylpp
emiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskd
liskllryhppqrlplkgvmehpwvkansrrvlppvyq
Sequence, based on observed residues (ATOM records): (download)
>d5k3yb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
alaempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehql
rreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfme
eladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrmcgtldylppe
miegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdl
iskllryhppqrlplkgvmehpwvkansrrvlppvyq
SCOPe Domain Coordinates for d5k3yb_:
Click to download the PDB-style file with coordinates for d5k3yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5k3yb_:
- d5k3yb_ first appeared in SCOPe 2.06
- d5k3yb_ appears in SCOPe 2.07
View in 3D
