Lineage for d5k35b2 (5k35 B:79-160)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348494Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2348495Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2348496Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2348523Protein automated matches [226933] (1 species)
    not a true protein
  7. 2348524Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)
  8. 2348540Domain d5k35b2: 5k35 B:79-160 [328938]
    Other proteins in same PDB: d5k35b1
    automated match to d3wsob2

Details for d5k35b2

PDB Entry: 5k35 (more details), 2.85 Å

PDB Description: structure of the legionella effector, ankb, in complex with human skp1
PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5k35b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k35b2 a.157.1.1 (B:79-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwc

SCOPe Domain Coordinates for d5k35b2:

Click to download the PDB-style file with coordinates for d5k35b2.
(The format of our PDB-style files is described here.)

Timeline for d5k35b2: