Lineage for d5jwza2 (5jwz A:417-731)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809651Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2809665Family b.69.13.0: automated matches [227242] (1 protein)
    not a true family
  6. 2809666Protein automated matches [227008] (11 species)
    not a true protein
  7. 2809739Species Streptomyces sp. [TaxId:862751] [318010] (1 PDB entry)
  8. 2809741Domain d5jwza2: 5jwz A:417-731 [318050]
    automated match to d5fkta2
    complexed with ca, edo

Details for d5jwza2

PDB Entry: 5jwz (more details), 1.7 Å

PDB Description: structure of a putative xyloglucanase from the cellulolytic bacteria streptomyces sp. sirexaa-e
PDB Compounds: (A:) Cellulose-binding family II

SCOPe Domain Sequences for d5jwza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jwza2 b.69.13.0 (A:417-731) automated matches {Streptomyces sp. [TaxId: 862751]}
gtfritpmvkgieetavndlasppsgapllsalgdiggfrhtdldavpdlmytspnldst
tsldfaesspgtvvrvgnsdaaphigfstdnganwfqgsepsgvtgggtvaaaadgsgfv
wspegagvhhttgfgtswtastgipagatvesdrknpekfygfeagtfyvstdggatfta
eatglpaegnvrfqalpgtegdiwlaggsdtgayglwrstdsgatftksagveqadsvgf
gkaapgasyrtvfvsakiggvrgifrstdagaswtrinddahqwgwtgaaitgdprvygr
vyvstngrgiqvget

SCOPe Domain Coordinates for d5jwza2:

Click to download the PDB-style file with coordinates for d5jwza2.
(The format of our PDB-style files is described here.)

Timeline for d5jwza2:

2809741
d5jwza2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5jwza1