Lineage for d5jrza1 (5jrz A:175-481)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.14: RNA helicase [52724] (7 proteins)
duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extensionProtein automated matches [226986] (8 species)
not a true protein
Species Zika virus [TaxId:64320] [317808] (28 PDB entries) 
Domain d5jrza1: 5jrz A:175-481 [319629]
Other proteins in same PDB: d5jrza2
automated match to d2bhra2
complexed with act, pop
Details for d5jrza1
PDB Entry: 5jrz (more details), 1.62 Å
PDB Description: structure of the ns3 helicase from the french polynesia strain of the zika virus
PDB Compounds: (A:) HelicaseSCOPe Domain Sequences for d5jrza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jrza1 c.37.1.14 (A:175-481) automated matches {Zika virus [TaxId: 64320]}
pvecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemee
alrglpvrymttavnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpss
iaargyistrvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtd
hsgktvwfvpsvrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisem
ganfkadrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylyg
ggcaetd
SCOPe Domain Coordinates for d5jrza1:
Click to download the PDB-style file with coordinates for d5jrza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jrza1:
- d5jrza1 first appeared in SCOPe 2.06
- d5jrza1 appears in SCOPe 2.07
View in 3D
