Lineage for d5jrya_ (5jry A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909152Species Burkholderia multivorans [TaxId:395019] [346328] (1 PDB entry)
  8. 2909153Domain d5jrya_: 5jry A: [345705]
    automated match to d5j6bb_
    complexed with act, gol, ndp

Details for d5jrya_

PDB Entry: 5jry (more details), 1.2 Å

PDB Description: crystal structure of a nad-dependent aldehyde dehydrogenase from burkholderia multivorans in covalent complex with nad
PDB Compounds: (A:) NAD-dependent aldehyde dehydrogenase

SCOPe Domain Sequences for d5jrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrya_ c.82.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mlketypyylanaavyantdlevtdkysgkvatrvaladakaidaaigaavdatkpmrel
paykrqavldhcvarfrerfdelaealcieagkpindakgevtrlidtfrvaseeavrid
gevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpas
rtpvgaliigevlaetdlpkgafsvlpahrdgadlfttddrfrllsftgspavgwalkek
agkkkvvlelggnaaaivdadqldrldyvvdrlafgafyqsgqscigvqrilahadiyda
lrdkliaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakivaggkvdgam
featllenvgrdqdlyrkeafgpiailekfdrfddalarvndsdfglqagvftdslahtq
qawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprllvvrrr

SCOPe Domain Coordinates for d5jrya_:

Click to download the PDB-style file with coordinates for d5jrya_.
(The format of our PDB-style files is described here.)

Timeline for d5jrya_: