Lineage for d5jpxa_ (5jpx A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642181Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 2642182Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 2642212Family g.43.1.0: automated matches [254230] (1 protein)
    not a true family
  6. 2642213Protein automated matches [254519] (2 species)
    not a true protein
  7. 2642214Species Human (Homo sapiens) [TaxId:9606] [255143] (2 PDB entries)
  8. 2642215Domain d5jpxa_: 5jpx A: [337522]
    automated match to d1frea_
    complexed with zn

Details for d5jpxa_

PDB Entry: 5jpx (more details)

PDB Description: solution structure of the trim21 b-box2 (b2)
PDB Compounds: (A:) e3 ubiquitin-protein ligase trim21

SCOPe Domain Sequences for d5jpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpxa_ g.43.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtqgercavhgerlhlfcekdgkalcwvcaqsrkhrdhamvplee

SCOPe Domain Coordinates for d5jpxa_:

Click to download the PDB-style file with coordinates for d5jpxa_.
(The format of our PDB-style files is described here.)

Timeline for d5jpxa_: