Class g: Small proteins [56992] (98 folds) |
Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) |
Family g.43.1.0: automated matches [254230] (1 protein) not a true family |
Protein automated matches [254519] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255143] (2 PDB entries) |
Domain d5jpxa_: 5jpx A: [337522] automated match to d1frea_ complexed with zn |
PDB Entry: 5jpx (more details)
SCOPe Domain Sequences for d5jpxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jpxa_ g.43.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gtqgercavhgerlhlfcekdgkalcwvcaqsrkhrdhamvplee
Timeline for d5jpxa_: