Lineage for d5jpgb_ (5jpg B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.0: automated matches [191363] (1 protein)
not a true familyProtein automated matches [190437] (70 species)
not a true protein
Species Norway rat (Rattus norvegicus) [TaxId:10116] [334399] (2 PDB entries) 
Domain d5jpgb_: 5jpg B: [334545]
automated match to d2d6pb_
complexed with na
Details for d5jpgb_
PDB Entry: 5jpg (more details), 1.9 Å
PDB Description: rat galectin 5 with lactose
PDB Compounds: (B:) Galectin-5SCOPe Domain Sequences for d5jpgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jpgb_ b.29.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pnlavpfftsipnglypsksivisgvvlsdakrfqinlrcggdiafhlnprfdenavvrn
tqinnswgpeerslpgsmpfsrgqrfsvwilceghcfkvavdgqhiceyshrlmnlpdin
tlevagdiqlthvet
SCOPe Domain Coordinates for d5jpgb_:
Click to download the PDB-style file with coordinates for d5jpgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jpgb_:
- d5jpgb_ first appeared in SCOPe 2.06
- d5jpgb_ appears in SCOPe 2.07
View in 3D
