Lineage for d5jn5a4 (5jn5 A:422-562)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. Protein automated matches [254722] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [316258] (14 PDB entries)
  8. Domain d5jn5a4: 5jn5 A:422-562 [329493]
    Other proteins in same PDB: d5jn5a1, d5jn5a2, d5jn5a3, d5jn5a5, d5jn5b1, d5jn5b2, d5jn5b3
    automated match to d5f9ca4
    complexed with ca, so4

Details for d5jn5a4

PDB Entry: 5jn5 (more details), 1.7500000000000002 Å

PDB Description: crystal structure of the d263y missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5jn5a4:

Sequence, based on SEQRES records: (download)

>d5jn5a4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records): (download)

>d5jn5a4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsggatirlyidsyekdvakinqdpqvmlaplisialk
vsqlqertgrtaptvit

SCOPe Domain Coordinates for d5jn5a4 are not available.

Timeline for d5jn5a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jn5a1, d5jn5a2, d5jn5a3, d5jn5a5
View in 3D
Domains from other chains:
(mouse over for more information)
d5jn5b1, d5jn5b2, d5jn5b3, d5jn5b4