Lineage for d5jjqa_ (5jjq A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. Protein automated matches [191083] (32 species)
    not a true protein
  7. Species Streptomyces sp. [TaxId:1265536] [331624] (1 PDB entry)
  8. Domain d5jjqa_: 5jjq A: [331650]
    Other proteins in same PDB: d5jjqd2
    automated match to d4d57a_
    complexed with 6l1, cl

Details for d5jjqa_

PDB Entry: 5jjq (more details), 2.6 Å

PDB Description: crystal structure of idnl1
PDB Compounds: (A:) AMP-dependent synthetase and ligase

SCOPe Domain Sequences for d5jjqa_:

Sequence, based on SEQRES records: (download)

>d5jjqa_ e.23.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 1265536]}
aqnpverlheflltgarltpekpavlelsgtepgyvsyrqlanraesyaaalgglgldig
drvvlesdtsasaiaallacsslglpfvpvtpetpakrllavvdtvspalylqaeggrre
glpesvgtgrfgpgglvieraprpgrgfrrevapadpaymvftsgstgrpkgvvmshrai
lsfyrgmlsqgivgpesrvastapfqfdfslldiglalgsgatvvpvprallrwprrfvr
flrdseatqvngapsiwrgalrheadelaalggrirgvlfsgepfplpevralqqalpla
rivncfgstesvaasftdvprpvpdgltklsighahpgaemmlldddgvpvtepgvtghi
hlrsgslftgywgdpeataralvpdptnpmtgqtvfrtgdlahrdatgelyfdgradnqv
kirgnrvelteverrvaeftgvaaasavllpvaesdpvlavfvelspgaefdemelgafc
leelpdymapqrihvldalp

Sequence, based on observed residues (ATOM records): (download)

>d5jjqa_ e.23.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 1265536]}
aqnpverlheflltgarltpekpavlelsgtepgyvsyrqlanraesyaaalgglgldig
drvvlesdtsasaiaallacsslglpfvpvtpetpakrllavvdtvspalylqaeggrre
glpesvgtgrfgpgglvieraprpgrgfrrevapadpaymvftpkgvvmshrailsfyrg
mlsqgivgpesrvastapfqfdfslldiglalgsgatvvpvprallrwprrfvrflrdse
atqvngapsiwrgalrheadelaalggrirgvlfsgepfplpevralqqalplarivncf
gstesvaasftdvprpvpdgltklsighahpgaemmlldddgvpvtepgvtghihlrsgs
lftgywgdpeataralvpdptnpmtgqtvfrtgdlahrdatgelyfdgradnqvkirgnr
velteverrvaeftgvaaasavllpvlavfvelspgaefdemelgafcleelpdymapqr
ihvldalp

SCOPe Domain Coordinates for d5jjqa_ are not available.

Timeline for d5jjqa_:

Domains from other chains:
(mouse over for more information)
d5jjqb_, d5jjqc_, d5jjqd1, d5jjqd2