![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
![]() | Domain d5j87b_: 5j87 B: [333230] automated match to d4z3va_ complexed with n42 |
PDB Entry: 5j87 (more details), 1.59 Å
SCOPe Domain Sequences for d5j87b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j87b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefie eakvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckd vceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrws ppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlase kvytimyscwhekaderptfkillsnildvmdee
Timeline for d5j87b_: