Lineage for d5j79a_ (5j79 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d5j79a_: 5j79 A: [317558]
    automated match to d5ar5b_
    complexed with 6ge, so4

Details for d5j79a_

PDB Entry: 5j79 (more details), 2.69 Å

PDB Description: the identification and pharmacological characterization of 6-(tert- butylsulfonyl)-n-(5-fluoro-1h-indazol-3-yl)quinolin-4-amine (gsk583), a highly potent and selective inhibitor of rip2 kinase, compound 3 complex
PDB Compounds: (A:) receptor-interacting serine/threonine-protein kinase 2

SCOPe Domain Sequences for d5j79a_:

Sequence, based on SEQRES records: (download)

>d5j79a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngeaicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlhihtplldserk
dvlreaeilhkarfsyilpilgicnepeflgivteympngslnellhrkteypdvawplr
frilheialgvnylhnmtppllhhdlktqnilldnefhvkiadfglskwrmmslsqsrss
ksapeggtiiymppenyepgqksrasikhdiysyavitwevlsrkqpfedvtnplqimys
vsqghrpvineeslpydiphrarmisliesgwaqnpderpsflkclielepvlrtfeeit
fleaviqlk

Sequence, based on observed residues (ATOM records): (download)

>d5j79a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngeaicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlrkdvlreaeilh
karfsyilpilgicnepeflgivteympngslnellhrkteypdvawplrfrilheialg
vnylhnmtppllhhdlktqnilldnefhvkiadfglskwrmsapeggtiiymppenyeps
ikhdiysyavitwevlsrkqpfedvtnplqimysvsqghrpvineeslpydiphrarmis
liesgwaqnpderpsflkclielepvlrtfeeitfleaviqlk

SCOPe Domain Coordinates for d5j79a_ are not available.

Timeline for d5j79a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5j79b_