Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (32 species) not a true protein |
Species Peptoclostridium difficile [TaxId:645463] [322996] (1 PDB entry) |
Domain d5j6ca_: 5j6c A: [323012] automated match to d3e10b_ complexed with fmn, imd |
PDB Entry: 5j6c (more details), 2.1 Å
SCOPe Domain Sequences for d5j6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j6ca_ d.90.1.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]} migflkkrrsirkykdvevekekldkilkaallapsskglrtwefivvddkeklinlsqc rtkgggfflknaplaiviiadkekndvwiedasiaasyiqlqahelglgscwiqvrnrmy ddnieadkyireelkvpskysveciisigysdeekkayndsdldykkvhfnnf
Timeline for d5j6ca_: