Lineage for d5j6ca_ (5j6c A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963529Species Peptoclostridium difficile [TaxId:645463] [322996] (1 PDB entry)
  8. 2963530Domain d5j6ca_: 5j6c A: [323012]
    automated match to d3e10b_
    complexed with fmn, imd

Details for d5j6ca_

PDB Entry: 5j6c (more details), 2.1 Å

PDB Description: fmn-dependent nitroreductase (cdr20291_0767) from clostridium difficile r20291
PDB Compounds: (A:) Putative reductase

SCOPe Domain Sequences for d5j6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6ca_ d.90.1.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]}
migflkkrrsirkykdvevekekldkilkaallapsskglrtwefivvddkeklinlsqc
rtkgggfflknaplaiviiadkekndvwiedasiaasyiqlqahelglgscwiqvrnrmy
ddnieadkyireelkvpskysveciisigysdeekkayndsdldykkvhfnnf

SCOPe Domain Coordinates for d5j6ca_:

Click to download the PDB-style file with coordinates for d5j6ca_.
(The format of our PDB-style files is described here.)

Timeline for d5j6ca_: