Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) possibly related to the ubiquitin-like superfamily |
Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins) |
Protein automated matches [190522] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries) |
Domain d5io9b_: 5io9 B: [315096] Other proteins in same PDB: d5io9a2 automated match to d1mfwa_ |
PDB Entry: 5io9 (more details), 1.3 Å
SCOPe Domain Sequences for d5io9b_:
Sequence, based on SEQRES records: (download)
>d5io9b_ d.15.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr kigsmdeleegesyvcssdnffddveytknvnpnwsvn
>d5io9b_ d.15.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsnlpqgvryiytidgsrkig smdeleegesyvcssdnffddveytknvnpnwsvn
Timeline for d5io9b_: