Lineage for d5io9b_ (5io9 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2180379Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 2180380Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)
  6. 2180389Protein automated matches [190522] (1 species)
    not a true protein
  7. 2180390Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)
  8. 2180392Domain d5io9b_: 5io9 B: [315096]
    Other proteins in same PDB: d5io9a2
    automated match to d1mfwa_

Details for d5io9b_

PDB Entry: 5io9 (more details), 1.3 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin
PDB Compounds: (B:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5io9b_:

Sequence, based on SEQRES records: (download)

>d5io9b_ d.15.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnwsvn

Sequence, based on observed residues (ATOM records): (download)

>d5io9b_ d.15.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsnlpqgvryiytidgsrkig
smdeleegesyvcssdnffddveytknvnpnwsvn

SCOPe Domain Coordinates for d5io9b_:

Click to download the PDB-style file with coordinates for d5io9b_.
(The format of our PDB-style files is described here.)

Timeline for d5io9b_: