Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [314718] (10 PDB entries) |
Domain d5i2kb_: 5i2k B: [315008] Other proteins in same PDB: d5i2ka_ automated match to d1pb7a_ complexed with 67h, glu, gly |
PDB Entry: 5i2k (more details), 2.86 Å
SCOPe Domain Sequences for d5i2kb_:
Sequence, based on SEQRES records: (download)
>d5i2kb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Human (Homo sapiens) [TaxId: 9606]} mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec
>d5i2kb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Human (Homo sapiens) [TaxId: 9606]} mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq ccygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivap ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec
Timeline for d5i2kb_: