| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
| Family b.1.33.0: automated matches [310673] (1 protein) not a true family |
| Protein automated matches [310872] (3 species) not a true protein |
| Species Escherichia coli [TaxId:340197] [329434] (4 PDB entries) |
| Domain d5i0ya_: 5i0y A: [329437] Other proteins in same PDB: d5i0yb2 automated match to d3lznb_ complexed with cu |
PDB Entry: 5i0y (more details), 1.4 Å
SCOPe Domain Sequences for d5i0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i0ya_ b.1.33.0 (A:) automated matches {Escherichia coli [TaxId: 340197]}
fkeypagepvtmnemelaavylqpidmeprgmglpaakadvhlqadihavegnkngfgag
ewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppska
gmhrhtdsetgvgrwwkpfdvsyefkyvgl
Timeline for d5i0ya_: