Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Scheffersomyces stipitis [TaxId:322104] [328851] (25 PDB entries) |
Domain d5hyva3: 5hyv A:532-677 [329552] Other proteins in same PDB: d5hyva1, d5hyva2 automated match to d1gpua3 complexed with 1pe, ca, tpp |
PDB Entry: 5hyv (more details), 1.03 Å
SCOPe Domain Sequences for d5hyva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hyva3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]} egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe gvaeraaktvafykgkdvvsplrsaf
Timeline for d5hyva3: