Lineage for d5hvlb_ (5hvl B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
consists of two non-similar domains with 3 layers (a/b/a) each
domain 1: parallel beta-sheet of 7 strands, order 3214567
domain 2: parallel beta-sheet of 6 strands, order 321456Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) 
Family c.87.1.0: automated matches [191559] (1 protein)
not a true familyProtein automated matches [190965] (40 species)
not a true protein
Species Candida albicans [TaxId:237561] [333712] (4 PDB entries) 
Domain d5hvlb_: 5hvl B: [333889]
automated match to d2wtxb_
complexed with so4, udp, vdm
Details for d5hvlb_
PDB Entry: 5hvl (more details), 1.8 Å
PDB Description: structure of candida albicans trehalose-6-phosphate synthase in complex with udp and validoxylamine a
PDB Compounds: (B:) Alpha,alpha-trehalose-phosphate synthase [UDP-forming]SCOPe Domain Sequences for d5hvlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hvlb_ c.87.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt
kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank
kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril
pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig
idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe
wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli
slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte
dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelyk
SCOPe Domain Coordinates for d5hvlb_:
Click to download the PDB-style file with coordinates for d5hvlb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hvlb_:
- d5hvlb_ first appeared in SCOPe 2.06
- d5hvlb_ appears in SCOPe 2.07
View in 3D
