Lineage for d5hgna2 (5hgn A:148-219)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-downSuperfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) 
Family a.28.3.0: automated matches [191629] (1 protein)
not a true familyProtein automated matches [191156] (12 species)
not a true protein
Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (32 PDB entries) 
Domain d5hgna2: 5hgn A:148-219 [321123]
Other proteins in same PDB: d5hgna1
automated match to d2m8pa2
Details for d5hgna2
PDB Entry: 5hgn (more details), 1.9 Å
PDB Description: hexameric hiv-1 ca, apo form
PDB Compounds: (A:) capsid protein p24SCOPe Domain Sequences for d5hgna2:
Sequence, based on SEQRES records: (download)
>d5hgna2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq
Sequence, based on observed residues (ATOM records): (download)
>d5hgna2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac
q
SCOPe Domain Coordinates for d5hgna2:
Click to download the PDB-style file with coordinates for d5hgna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hgna2:
View in 3D
